PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676714226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 183aa    MW: 20553.7 Da    PI: 5.6703
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676714226genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70287.43.3e-2766113350
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrr 50 
                s t+sCqdCGnqakk+C+ +RCRtCCks+g+dC thv+stW+p+akr+
  676714226  66 SVTISCQDCGNQAKKGCTNMRCRTCCKSQGLDCPTHVRSTWIPIAKRQ 113
                6789******************************************97 PP

2DUF70282.21.3e-2511316899154
     DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                +++ +++Peevss+a+frcvr+s+ ddg+ ++aYqt+v i+GhvfkGiLy+qG+e+
  676714226 113 QMDETTFPEEVSSDALFRCVRMSGTDDGDSQYAYQTTVGIAGHVFKGILYNQGPES 168
                577889************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.9E-2368113IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.0E-2770112IPR006510Zinc finger, lateral root primordium type 1
PfamPF051422.9E-22116167IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016244.5E-29119166IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MDGDGIGSSR NNEEENQQKT NWLWYRNTIS SSTSHNNQQQ IWQQQQSLDL YPGQINVCDV  60
TTSPRSVTIS CQDCGNQAKK GCTNMRCRTC CKSQGLDCPT HVRSTWIPIA KRQMDETTFP  120
EEVSSDALFR CVRMSGTDDG DSQYAYQTTV GIAGHVFKGI LYNQGPESMS MPGTQFYENP  180
PRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102280.11e-101PREDICTED: protein SHI RELATED SEQUENCE 4 isoform X2
SwissprotQ9SI193e-97SRS4_ARATH; Protein SHI RELATED SEQUENCE 4
TrEMBLM4FFP31e-101M4FFP3_BRARP; Uncharacterized protein
STRINGBra039917.1-P1e-101(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151171519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18120.17e-95SHI-related sequence 4